PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400049484
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family MIKC_MADS
Protein Properties Length: 196aa    MW: 22378.6 Da    PI: 10.226
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400049484genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF98.72.4e-312574150
                          S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
                SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                          krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+++fss+g+lyey+
  PGSC0003DMP400049484 25 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALVVFSSRGRLYEYA 74
                          79***********************************************8 PP

2K-box100.91.7e-3392173384
                 K-box   3 kssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkke 84 
                           +s++ s++ea+a+++qqe++kL+++i nLq+++R++lGe+L+s++ keL++Leq++ek+++kiRskKnell+++ie++qk+ 
  PGSC0003DMP400049484  92 SSNTGSVSEANAQYYQQEASKLRAQIGNLQNQNRNMLGESLGSMNSKELKSLEQKIEKGISKIRSKKNELLFAEIEYMQKRV 173
                           3445559*************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006633.5011777IPR002100Transcription factor, MADS-box
SMARTSM004321.4E-401776IPR002100Transcription factor, MADS-box
CDDcd002651.52E-431894No hitNo description
SuperFamilySSF554553.14E-331891IPR002100Transcription factor, MADS-box
PRINTSPR004043.8E-331939IPR002100Transcription factor, MADS-box
PROSITE patternPS0035001973IPR002100Transcription factor, MADS-box
PfamPF003196.9E-272673IPR002100Transcription factor, MADS-box
PRINTSPR004043.8E-333954IPR002100Transcription factor, MADS-box
PRINTSPR004043.8E-335475IPR002100Transcription factor, MADS-box
PfamPF014863.2E-24101174IPR002487Transcription factor, K-box
PROSITE profilePS5129712.671103195IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048366Biological Processleaf development
GO:0048440Biological Processcarpel development
GO:0048443Biological Processstamen development
GO:0048497Biological Processmaintenance of floral organ identity
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 196 aa     Download sequence    Send to blast
MDFQSDLTRE ISPQRKLGRG KIEIKRIENT TNRQVTFCKR RNGLLKKAYE LSVLCDAEVA  60
LVVFSSRGRL YEYANNSVKA TIERYKKACS DSSNTGSVSE ANAQYYQQEA SKLRAQIGNL  120
QNQNRNMLGE SLGSMNSKEL KSLEQKIEKG ISKIRSKKNE LLFAEIEYMQ KRVSHSTIFH  180
LVNFHFKLID PFSVI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P6e-211785169Myocyte-specific enhancer factor 2B
1tqe_Q6e-211785169Myocyte-specific enhancer factor 2B
1tqe_R6e-211785169Myocyte-specific enhancer factor 2B
1tqe_S6e-211785169Myocyte-specific enhancer factor 2B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00609ChIP-seqTransfer from AT4G18960Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankTOMTAG1A0.0L26295.1 Lycopersicon esculentum TAG1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006358069.11e-122PREDICTED: floral homeotic protein AGAMOUS isoform X3
SwissprotQ435851e-117AG_TOBAC; Floral homeotic protein AGAMOUS
TrEMBLM1CRK91e-142M1CRK9_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000731341e-121(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18960.14e-94MIKC_MADS family protein
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]